PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015897583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 307aa    MW: 33824.4 Da    PI: 6.176
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015897583.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.12.3e-105328579374
            GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelg 173
                     +a+++f+ +sP++kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s ++le+tg+rL++fA++lg
  XP_015897583.1   3 SAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPFVRLTGLGT----SVDALEATGKRLSDFADKLG 93 
                     7899*******************************************************************....9******************* PP

            GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                     +pfef + va+++ +l++++L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalf
  XP_015897583.1  94 LPFEFLP-VADKVGNLDPDRLNVSKREAVAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALF 180
                     *******.7*************************9..999999999999....**********************.899**************** PP

            GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                     dsl a++++eseer++vE++ll+rei+nv+a  g +r  + + +++Wre+++++GF+ ++l  +aa+qa lll +++s+gy++ e+sg+l lgWk
  XP_015897583.1 181 DSLGASYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGDVK-FHNWREKFQQCGFRGISLAGNAATQATLLLGMFPSEGYTLVEDSGTLKLGWK 274
                     ************************************888877.**************************************************** PP

            GRAS 364 drpLvsvSaWr 374
                     d  L+++SaWr
  XP_015897583.1 275 DLCLLTASAWR 285
                     **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.5091265IPR005202Transcription factor GRAS
PfamPF035148.1E-1033285IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
LASAFQVFNG ISPFVKFSHF TANQAIQEAF EREERVHIID LDIMQGLQWP GLFHILASRP  60
GGPPFVRLTG LGTSVDALEA TGKRLSDFAD KLGLPFEFLP VADKVGNLDP DRLNVSKREA  120
VAVHWLQHSL YDVTGSDTNT LWLLQRLAPK VVTVVEQDLS HAGSFLGRFV EAIHYYSALF  180
DSLGASYGEE SEERHVVEQQ LLSREIRNVL AVGGPSRSGD VKFHNWREKF QQCGFRGISL  240
AGNAATQATL LLGMFPSEGY TLVEDSGTLK LGWKDLCLLT ASAWRPPPSP FHTTTAITTP  300
TPTATLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-48128576375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015897583.10.0PREDICTED: protein SCARECROW-like, partial
RefseqXP_015897596.10.0PREDICTED: protein SCARECROW 2-like
SwissprotQ9AVK40.0SCR_PEA; Protein SCARECROW
TrEMBLC9WBB60.0C9WBB6_LUPAL; Scarecrow 1
STRINGPOPTR_0016s15060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein